DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and HOXC5

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_061826.1 Gene:HOXC5 / 3222 HGNCID:5127 Length:222 Species:Homo sapiens


Alignment Length:243 Identity:67/243 - (27%)
Similarity:93/243 - (38%) Gaps:70/243 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   344 SNAAANSSLSFSSSLANI-------CSNSNDSNSTATSS--------STTNTSGAP------VDL 387
            |:..||   ||.....||       |.|...::....|.        |.|....||      ||:
Human     2 SSYVAN---SFYKQSPNIPAYNMQTCGNYGSASEVQASRYCYGGLDLSITFPPPAPSNSLHGVDM 63

  Fly   388 VKSP---PPAAGAGATGASGKS-GEDSGTPIVWPAWVYCTRYSDRPSSGRSP--RARKPKKPATS 446
            ..:|   |......|..|.|.: |.|...|:                   :|  .::|..:||..
Human    64 AANPRAHPDRPACSAAAAPGHAPGRDEAAPL-------------------NPGMYSQKAARPALE 109

  Fly   447 SSAAGGGGGGVEKGEAADGGGV---------------------PEDKRPRTAFSGTQLARLKHEF 490
            ..|...|....|:.:.....|:                     .:.||.||:::..|...|:.||
Human   110 ERAKSSGEIKEEQAQTGQPAGLSQPPAPPQIYPWMTKLHMSHETDGKRSRTSYTRYQTLELEKEF 174

  Fly   491 NENRYLTEKRRQQLSGELGLNEAQIKIWFQNKRAKLKKSSGTKNPLAL 538
            :.|||||.:||.:::..|.|||.||||||||:|.|.||.|..|:..||
Human   175 HFNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKKDSKMKSKEAL 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 27/52 (52%)
Engrail_1_C_sig 529..554 CDD:287495 4/10 (40%)
HOXC5NP_061826.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..141 15/91 (16%)
Antp-type hexapeptide 140..145 0/4 (0%)
Homeobox 158..211 CDD:306543 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.