DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and HOXB8

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_076921.1 Gene:HOXB8 / 3218 HGNCID:5119 Length:243 Species:Homo sapiens


Alignment Length:179 Identity:53/179 - (29%)
Similarity:70/179 - (39%) Gaps:62/179 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   395 AGAGATGASGKSGEDSGTPIVWPAWVYCTRYSDRPSSGRSPRARKPKKPATSSSAAGGGGGGVEK 459
            |.|...|...:..|.|.:|.....|:       ||                 .:|||        
Human   113 AAASGLGEEAEGSEQSPSPTQLFPWM-------RP-----------------QAAAG-------- 145

  Fly   460 GEAADGGGVPEDKRPRTAFSGTQLARLKHEFNENRYLTEKRRQQLSGELGLNEAQIKIWFQNKRA 524
                       .:|.|..:|..|...|:.||..|.|||.|||.::|..|||.|.|:||||||:|.
Human   146 -----------RRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRM 199

  Fly   525 KLKKSSGTKNPLALQLMAQGLYNHSTIPLTR-EEEEL--QELQEAASAA 570
            |.||.:                |....|.:: |:|||  |:|:.|..||
Human   200 KWKKEN----------------NKDKFPSSKCEQEELEKQKLERAPEAA 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 27/52 (52%)
Engrail_1_C_sig 529..554 CDD:287495 2/24 (8%)
HOXB8NP_076921.1 Antp-type hexapeptide 134..139 1/11 (9%)
Homeobox 150..203 CDD:395001 27/52 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..243 12/46 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.