DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and HOXB7

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_004493.3 Gene:HOXB7 / 3217 HGNCID:5118 Length:217 Species:Homo sapiens


Alignment Length:245 Identity:70/245 - (28%)
Similarity:97/245 - (39%) Gaps:64/245 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 SSLSFSSSLANICSNSNDSNSTATSSSTTNTSGAPVDLVKSPPPAAGAGAT----------GASG 404
            |||.::::|.:....|  |:..||.:....||.|.....:.|...||:||:          |..|
Human     2 SSLYYANTLFSKYPAS--SSVFATGAFPEQTSCAFASNPQRPGYGAGSGASFAASMQGLYPGGGG 64

  Fly   405 KSGEDSGTPIVWPAWVYCTRYSDRPSS-----------------GRSPRARKPKKPATSSSAAGG 452
            .:|:.:       |.||...|...|||                 |.|.:|...|:...|..||..
Human    65 MAGQSA-------AGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAAES 122

  Fly   453 G--------GGGVEKGEAADGGGVPEDKRPRTAFSGTQLARLKHEFNENRYLTEKRRQQLSGELG 509
            .        ..|.::            ||.|..::..|...|:.||:.|||||.:||.:::..|.
Human   123 NFRIYPWMRSSGTDR------------KRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLC 175

  Fly   510 LNEAQIKIWFQNKRAKLKKSSGTKNPLALQLMAQGLYNHSTIPLTREEEE 559
            |.|.||||||||:|.|.||.:.|..|        |...........||||
Human   176 LTERQIKIWFQNRRMKWKKENKTAGP--------GTTGQDRAEAEEEEEE 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 25/52 (48%)
Engrail_1_C_sig 529..554 CDD:287495 3/24 (13%)
HOXB7NP_004493.3 Antp-type hexapeptide 126..131 0/4 (0%)
Homeobox 141..193 CDD:278475 25/51 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..217 6/30 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.