DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and HOXB3

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:XP_016880049.1 Gene:HOXB3 / 3213 HGNCID:5114 Length:578 Species:Homo sapiens


Alignment Length:417 Identity:112/417 - (26%)
Similarity:142/417 - (34%) Gaps:151/417 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 ALKFSIDNILKADFGSRLP----KIGALSGNI------------------------GGGSVSGSS 312
            |||..:....:...|||.|    :.|:.|||.                        |||.|..|:
Human    26 ALKARVQLGARRARGSRSPARPGRSGSFSGNWRLPRPECQIRALLGPWRPNKAGGGGGGGVGASA 90

  Fly   313 TGSSKNSGNTNG-----------------NRSP---------------------LKAPKKSGKPL 339
            :|.....|.|.|                 .|||                     .:.|:.||:|.
Human    91 SGPLPQLGGTLGGCWGLLRVERLGCGWLRRRSPSLGRGSGAWQSAPARTQRPAARRCPRPSGRPH 155

  Fly   340 NLAQSNAAANSSLS---------FSSSLA------------NICSNSNDSNSTATSSSTTNTSG- 382
            .....:.||.|...         ..||:|            :.||..:..|: |..:.:...:| 
Human   156 RRGDLSPAARSGARCEYILCLPVLPSSVAKAATHLEGDYQRSACSLQSLGNA-APHAKSKELNGS 219

  Fly   383 ------APVDLVK---SPPP-AAGAGATGASGKSG--EDSGTPIVWPA-----------WVYCTR 424
                  ||..|..   |||| ||...||..|...|  ..||.|...|.           |:    
Human   220 CMRPGLAPEPLSAPPGSPPPSAAPTSATSNSSNGGGPSKSGPPKCGPGTNSTLTKQIFPWM---- 280

  Fly   425 YSDRPSSGRSPRARKPKKPATSSSAAGGGGGGVEKGEAADGG-------------GVPEDKRPRT 476
                 ...|.....|...|.|:....||||||...|....||             |....||.||
Human   281 -----KESRQTSKLKNNSPGTAEGCGGGGGGGGGGGSGGSGGGGGGGGGGDKSPPGSAASKRART 340

  Fly   477 AFSGTQLARLKHEFNENRYLTEKRRQQLSGELGLNEAQIKIWFQNKRAKLKK---------SSGT 532
            |::..||..|:.||:.||||...||.:::..|.|:|.||||||||:|.|.||         |||.
Human   341 AYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKKDQKAKGLASSSGG 405

  Fly   533 KNPLA-----LQLMAQGLYN--HSTIP 552
            .:|..     :|..| |..|  ||..|
Human   406 PSPAGSPPQPMQSTA-GFMNALHSMTP 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 27/52 (52%)
Engrail_1_C_sig 529..554 CDD:287495 11/31 (35%)
HOXB3XP_016880049.1 Homeobox 339..391 CDD:278475 27/51 (53%)
DUF4074 513..576 CDD:290032
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.