DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and HOXA3

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001371264.1 Gene:HOXA3 / 3200 HGNCID:5104 Length:443 Species:Homo sapiens


Alignment Length:183 Identity:57/183 - (31%)
Similarity:82/183 - (44%) Gaps:60/183 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   380 TSGAPVDLVKSPPPAAGAGATGASGKSGEDSGTPIVWPAWVYCTRYSDRPSSGRSP--------- 435
            |..||      |||::.:....||     ::.||               .::.:||         
Human   115 TPAAP------PPPSSASPPQNAS-----NNPTP---------------ANAAKSPLLNSPTVAK 153

  Fly   436 -------RARKPKKPATSSSAAGGGGGGVEK--GEAADGGGVPEDKRPRTAFSGTQLARLKHEFN 491
                   .:|:..|..||||::|....|.:.  |:|:       .||.|||::..||..|:.||:
Human   154 QIFPWMKESRQNTKQKTSSSSSGESCAGDKSPPGQAS-------SKRARTAYTSAQLVELEKEFH 211

  Fly   492 ENRYLTEKRRQQLSGELGLNEAQIKIWFQNKRAKLKK---------SSGTKNP 535
            .||||...||.:::..|.|.|.||||||||:|.|.||         |||.::|
Human   212 FNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKGKGMLTSSGGQSP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 27/52 (52%)
Engrail_1_C_sig 529..554 CDD:287495 4/7 (57%)
HOXA3NP_001371264.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..147 12/57 (21%)
Antp-type hexapeptide 155..160 0/4 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..196 12/43 (28%)
Homeobox 195..248 CDD:395001 27/52 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 247..338 6/18 (33%)
DUF4074 378..441 CDD:404218
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 400..443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.