DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and HOXA2

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_006726.1 Gene:HOXA2 / 3199 HGNCID:5103 Length:376 Species:Homo sapiens


Alignment Length:237 Identity:67/237 - (28%)
Similarity:102/237 - (43%) Gaps:32/237 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 SLANICSNSNDSNSTATSSSTTNTSGAPVDLVKSPP-----PAAGAGATGASGKSGEDSGTPIVW 416
            |||. |..|....:....||:..||......:..||     |:...|:....|..|....:|.  
Human    17 SLAE-CLTSFPPVADTFQSSSIKTSTLSHSTLIPPPFEQTIPSLNPGSHPRHGAGGRPKPSPA-- 78

  Fly   417 PAWVYCTRYSDRPSSGRSP------RARKPKK-----PATSSSAAGGGGGGV-----EKGEAADG 465
                 .:|.|..|:....|      :.:|..|     ||.:::|.....|..     |..|.|||
Human    79 -----GSRGSPVPAGALQPPEYPWMKEKKAAKKTALLPAAAAAATAAATGPACLSHKESLEIADG 138

  Fly   466 GGVPEDKRPRTAFSGTQLARLKHEFNENRYLTEKRRQQLSGELGLNEAQIKIWFQNKRAKLKKSS 530
            .| ...:|.|||::.|||..|:.||:.|:||...||.:::..|.|.|.|:|:||||:|.|.|:.:
Human   139 SG-GGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQT 202

  Fly   531 GTKNPLALQLMAQGLYNHSTIPLTREEEELQELQEAASAAAA 572
            ..|.....:...:.|.:...:  ..:|||....::|.|.:.|
Human   203 QCKENQNSEGKCKSLEDSEKV--EEDEEEKTLFEQALSVSGA 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 25/52 (48%)
Engrail_1_C_sig 529..554 CDD:287495 2/24 (8%)
HOXA2NP_006726.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..93 10/57 (18%)
Antp-type hexapeptide 94..99 0/4 (0%)
Homeobox 147..200 CDD:395001 25/52 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..229 4/32 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..279
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.