Sequence 1: | NP_523699.3 | Gene: | inv / 36239 | FlyBaseID: | FBgn0001269 | Length: | 576 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571256.1 | Gene: | hoxb8b / 30420 | ZFINID: | ZDB-GENE-980526-291 | Length: | 247 | Species: | Danio rerio |
Alignment Length: | 212 | Identity: | 55/212 - (25%) |
---|---|---|---|
Similarity: | 83/212 - (39%) | Gaps: | 66/212 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 407 GEDSGTPIVWPAWVYCTRYSDRPSSGRS--PRARKPKKP---ATSSSAAGG--GGGGVEKGE--- 461
Fly 462 AADG------------GGVPED----------------------KRPRTAFSGTQLARLKHEFNE 492
Fly 493 NRYLTEKRRQQLSGELGLNEAQIKIWFQNKRAKLKKSSGTKNPLALQLMAQGLYNHSTIPLTR-E 556
Fly 557 EEELQELQEAASAAAAK 573 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
inv | NP_523699.3 | Homeobox | 474..527 | CDD:278475 | 26/52 (50%) |
Engrail_1_C_sig | 529..554 | CDD:287495 | 2/24 (8%) | ||
hoxb8b | NP_571256.1 | Antp-type hexapeptide | 134..139 | 0/4 (0%) | |
Homeobox | 149..201 | CDD:278475 | 26/51 (51%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 201..247 | 9/48 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |