DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and hoxb3a

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_571192.2 Gene:hoxb3a / 30339 ZFINID:ZDB-GENE-990415-104 Length:417 Species:Danio rerio


Alignment Length:286 Identity:82/286 - (28%)
Similarity:117/286 - (40%) Gaps:66/286 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 GGGSVSGSS-------TGSSKNSGNTNGN--RS--PLKAPKKSGKPLNLAQSNAAANSSLSFSSS 357
            ||.|..|::       ..:.:||.:..|:  ||  .|::...|..|    |...|....|:.|..
Zfish    14 GGYSYQGANGFGYDAPAPAFQNSAHLEGDYQRSACSLQSLGTSAPP----QPQHAKTKELNGSCM 74

  Fly   358 LANICSNSNDSNSTATSSSTTNTSGAPVDLVKSPPPAAGAGATGASGKSGEDSG----------T 412
            ..::....:.....:...:|.|.  |..:..:.|..:.|.|..|:.|.|...|.          |
Zfish    75 RPSLPPEHHPPPQVSPPQNTVNV--AATNATQQPGGSGGGGVAGSGGTSKSSSKSSSMATNPTLT 137

  Fly   413 PIVWPAWVYCTRYSDRPSSGRSPRARKPKKPATSSSAAGGGGGGVEK---GEAADGGGVPEDKRP 474
            ..::| |:         ...|....:|...|:.||:.|...||  ||   |.||       .||.
Zfish   138 KQIFP-WM---------KESRQNTKQKNSSPSASSANAESSGG--EKSPPGSAA-------SKRA 183

  Fly   475 RTAFSGTQLARLKHEFNENRYLTEKRRQQLSGELGLNEAQIKIWFQNKRAKLKKSSGTKN----- 534
            |||::..||..|:.||:.||||...||.:::..|.|:|.||||||||:|.|.||...:|.     
Zfish   184 RTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKKDQKSKGIGSSS 248

  Fly   535 ---------PLALQLMAQGLYN--HS 549
                     ||.:|..| |..|  ||
Zfish   249 GGPSPTGSPPLPMQSSA-GFMNSMHS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 27/52 (52%)
Engrail_1_C_sig 529..554 CDD:287495 9/37 (24%)
hoxb3aNP_571192.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..135 16/89 (18%)
Antp-type hexapeptide 140..145 2/14 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 147..184 15/45 (33%)
Homeobox 184..236 CDD:278475 27/51 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 237..290 10/38 (26%)
DUF4074 353..415 CDD:290032
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 381..417
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.