DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and hoxb2a

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_571191.1 Gene:hoxb2a / 30338 ZFINID:ZDB-GENE-990415-103 Length:390 Species:Danio rerio


Alignment Length:254 Identity:68/254 - (26%)
Similarity:108/254 - (42%) Gaps:51/254 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 SSLSFSSSLANICSNSNDSNSTAT-------SSSTTNTSGAPVDLVKSPPPAAGAGATGASGKSG 407
            ||:..|:::.....::..|.|..|       |...|.::|..:....:||.....|....||   
Zfish    35 SSIKDSTAIPPPFEHTIPSLSPCTGNQARPRSQKRTASNGLQLRTQTAPPTQHQQGPAPLSG--- 96

  Fly   408 EDSGTPIV--WPAWVYCTRYSDRPSSGRSPRARKPKKPATSSSAAGGGG---GGVEKGEAADGG- 466
               |.|:.  :| |:     .::.||.:.|:.......|.:|.:....|   .|:|......|| 
Zfish    97 ---GAPLAHEFP-WM-----KEKKSSKKCPKPGATAAAAAASPSQASSGYTTAGLESPTEIQGGL 152

  Fly   467 -GVPEDKRPRTAFSGTQLARLKHEFNENRYLTEKRRQQLSGELGLNEAQIKIWFQNKRAKLKKSS 530
             .|...:|.|||::.|||..|:.||:.|:||...||.:::..|.|.|.|:|:||||:|.|.|:.:
Zfish   153 DNVSGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQT 217

  Fly   531 -----GTK-NPLALQLM----AQGLYNHSTIPLTREEEELQELQEAASAAAA---KEPC 576
                 |.: .|....|:    |...|:.            |.|:.:.|.:||   .|.|
Zfish   218 THHRDGQEGEPSGFDLLEGTDASSPYSS------------QSLEVSGSGSAAPSESETC 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 25/52 (48%)
Engrail_1_C_sig 529..554 CDD:287495 5/34 (15%)
hoxb2aNP_571191.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..73 6/32 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..100 6/24 (25%)
Antp-type hexapeptide 103..108 2/10 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 108..155 10/46 (22%)
Homeobox 162..214 CDD:278475 25/51 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 211..338 14/66 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.