DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and hoxa2b

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_571181.1 Gene:hoxa2b / 30325 ZFINID:ZDB-GENE-990415-98 Length:363 Species:Danio rerio


Alignment Length:204 Identity:58/204 - (28%)
Similarity:91/204 - (44%) Gaps:40/204 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 NSSLSFSSSLANICSNSNDSNSTATSSSTTNTSGAPVDLVKSPPP--------AAGAGATGASGK 405
            ||..|.:..|.:.....:...|::..|||.:.|    .|:  |||        ..|:....:..|
Zfish    13 NSQPSLAECLTSFPPVGDAFQSSSIKSSTLSHS----TLI--PPPFEQTIPSLNPGSHPRHSRPK 71

  Fly   406 SGEDSGTPIVWPAWVYCTRYSDRPSSGRSP------RARKPKKPATSSSAAGGGGGGV---EKG- 460
            ...:...|:              |::...|      ..:..||..|:|:||....|.:   .:| 
Zfish    72 QNPNGSCPL--------------PAASLPPEYPWMKEKKASKKNQTTSTAATTDPGPLYFSPQGS 122

  Fly   461 -EAADGGGVPEDKRPRTAFSGTQLARLKHEFNENRYLTEKRRQQLSGELGLNEAQIKIWFQNKRA 524
             |.:|||. ...:|.|||::.|||..|:.||:.|:||...||.:::..|.|.|.|:|:||||:|.
Zfish   123 PEISDGGS-GATRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRM 186

  Fly   525 KLKKSSGTK 533
            |.|:.:..|
Zfish   187 KHKRQTQCK 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 25/52 (48%)
Engrail_1_C_sig 529..554 CDD:287495 1/5 (20%)
hoxa2bNP_571181.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..132 22/110 (20%)
Antp-type hexapeptide 88..93 0/4 (0%)
Homeobox 137..189 CDD:278475 25/51 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..218 3/10 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 245..279
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.