DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and hoxb5a

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_571176.2 Gene:hoxb5a / 30317 ZFINID:ZDB-GENE-980526-70 Length:275 Species:Danio rerio


Alignment Length:257 Identity:68/257 - (26%)
Similarity:110/257 - (42%) Gaps:56/257 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 GALSGNIGGGSVSGSSTGSSKNSGNTNGNRSPLKAPKKSGKPLNLAQSNAAANSSLSFSSSLANI 361
            |:...|..|..:|.:.:.|:.:.|....|....::|        ..::.....||.|.:|.....
Zfish    44 GSYGYNYNGMDLSVNRSTSTGHFGAVGDNSRVFQSP--------APETRFRQPSSCSLASPEPLP 100

  Fly   362 CSN------------SNDSNSTATSSSTTNTSGAPVDLVKSPPPAAGAGATGASGKSGEDSGTPI 414
            |||            |:.|.:||.::..:||....:|            ...||.::.|.|    
Zfish   101 CSNSESLGPKGSSPPSDQSTTTAGNNLNSNTHFTEID------------EASASSETEEAS---- 149

  Fly   415 VWPAWVYCTRYSDRPSSGRSPRA-RKPKKPATSSSAAGGGGGG------VEKGEAADGGGVPEDK 472
                         ..::..:||. :|.:..|||:::|...|..      :.|...:.....|:.|
Zfish   150 -------------HRANNSAPRTQQKQETTATSTTSATSDGQAPQIFPWMRKLHISHDMTGPDGK 201

  Fly   473 RPRTAFSGTQLARLKHEFNENRYLTEKRRQQLSGELGLNEAQIKIWFQNKRAKLKKSSGTKN 534
            |.|||::..|...|:.||:.|||||.:||.:::..|.|:|.||||||||:|.|.||.:..|:
Zfish   202 RARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKS 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 27/52 (52%)
Engrail_1_C_sig 529..554 CDD:287495 1/6 (17%)
hoxb5aNP_571176.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..181 28/147 (19%)
Antp-type hexapeptide 182..187 0/4 (0%)
Homeobox 204..256 CDD:278475 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.