DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and en2a

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_571119.2 Gene:en2a / 30243 ZFINID:ZDB-GENE-980526-167 Length:265 Species:Danio rerio


Alignment Length:301 Identity:123/301 - (40%)
Similarity:154/301 - (51%) Gaps:82/301 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 NENLHERALKFSIDNILKADFG-SRLPKIGALSGNIG---GGSVSGSSTGS------SKNSGNTN 323
            |..|..|...|.|||||:.||| .:...|.....|.|   ..:.:|.|||.      ::.:..|:
Zfish    33 NLQLPHRITNFFIDNILRPDFGRKKEANITRYEDNHGARENHNPTGPSTGQVGSTVPAEEASTTH 97

  Fly   324 GNRSPLKAPKKSGKPLNLAQSNAAANSSLSFSSSLANICSNSNDSNSTATSSSTTNTSGAPVDLV 388
            .:....:|..:|.:||.....|             .:.|..|.      :.||.:|::|      
Zfish    98 TSSGGKEAEIESEEPLKPRGEN-------------VDQCLGSE------SDSSQSNSNG------ 137

  Fly   389 KSPPPAAGAGATGASGKSGEDSGTPIVWPAWVYCTRYSDRPSSGRSPRARKPKKPATSSSAAGGG 453
                                .:|..::|||||||||||||||||  ||:|||||.|.|.      
Zfish   138 --------------------QTGQGMLWPAWVYCTRYSDRPSSG--PRSRKPKKKAASK------ 174

  Fly   454 GGGVEKGEAADGGGVPEDKRPRTAFSGTQLARLKHEFNENRYLTEKRRQQLSGELGLNEAQIKIW 518
                            |||||||||:..||.|||.||..||||||:|||.|:.||||||:|||||
Zfish   175 ----------------EDKRPRTAFTAEQLQRLKAEFQTNRYLTEQRRQSLAQELGLNESQIKIW 223

  Fly   519 FQNKRAKLKKSSGTKNPLALQLMAQGLYNHSTIPLTREEEE 559
            |||||||:||:||.||.||:.|||||||||||   |.:|::
Zfish   224 FQNKRAKIKKASGVKNGLAIHLMAQGLYNHST---TSKEDK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 40/52 (77%)
Engrail_1_C_sig 529..554 CDD:287495 17/24 (71%)
en2aNP_571119.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..142 19/121 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..180 20/48 (42%)
Homeobox 179..232 CDD:278475 40/52 (77%)
Engrail_1_C_sig 234..263 CDD:287495 19/31 (61%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 97 1.000 Domainoid score I7156
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002003
OrthoInspector 1 1.000 - - mtm6346
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24341
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1139
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
88.010

Return to query results.
Submit another query.