DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and en2b

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_571115.1 Gene:en2b / 30238 ZFINID:ZDB-GENE-980526-40 Length:261 Species:Danio rerio


Alignment Length:303 Identity:119/303 - (39%)
Similarity:152/303 - (50%) Gaps:96/303 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 LHERALKFSIDNILKADFGSRLPKIGALSGNI-------------GGGS---VSGSSTGSSKNSG 320
            |..|...|.|||||:.|||.|  |.|:....|             |.|.   |||..|.|.:   
Zfish    35 LPHRITNFYIDNILRPDFGRR--KEGSRRDEINIVERENRCPSAPGSGQVAPVSGEGTSSPR--- 94

  Fly   321 NTNGNRSPLKAPKKSGKPLNLAQSNAAANSSLSFSSSLANICSNSNDSNSTATSSSTTNTSGAPV 385
                   .:.|.||         ::.:.:.||...:...:.|. |:||:                
Zfish    95 -------AVNASKK---------TDISTDESLKSRAETGDQCL-SSDSD---------------- 126

  Fly   386 DLVKSPPPAAGAGATGASGKSGEDSGTPIVWPAWVYCTRYSDRPSSGRSPRARKPKKPATSSSAA 450
                            .|.:....:..|::|||||||||||||||||  ||:|||||...:.   
Zfish   127 ----------------CSQRCAAQAKQPMLWPAWVYCTRYSDRPSSG--PRSRKPKKKTPTK--- 170

  Fly   451 GGGGGGVEKGEAADGGGVPEDKRPRTAFSGTQLARLKHEFNENRYLTEKRRQQLSGELGLNEAQI 515
                               |||||||||:..||.|||:||..||||||:|||.|:.||||||:||
Zfish   171 -------------------EDKRPRTAFTAEQLQRLKNEFQNNRYLTEQRRQALAQELGLNESQI 216

  Fly   516 KIWFQNKRAKLKKSSGTKNPLALQLMAQGLYNHSTIPLTREEE 558
            ||||||||||:||::|.||.||:.|||||||||:|:  |::::
Zfish   217 KIWFQNKRAKIKKATGNKNTLAVHLMAQGLYNHATV--TKDDK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 40/52 (77%)
Engrail_1_C_sig 529..554 CDD:287495 15/24 (63%)
en2bNP_571115.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..125 19/93 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..176 17/47 (36%)
Homeobox 175..228 CDD:278475 40/52 (77%)
Engrail_1_C_sig 230..259 CDD:287495 16/30 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 97 1.000 Domainoid score I7156
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002003
OrthoInspector 1 1.000 - - mtm6346
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24341
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1139
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
88.010

Return to query results.
Submit another query.