DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and Hoxd3

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001257967.1 Gene:Hoxd3 / 288152 RGDID:1588601 Length:432 Species:Rattus norvegicus


Alignment Length:309 Identity:80/309 - (25%)
Similarity:109/309 - (35%) Gaps:104/309 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 NILKADFGS-----------RLPKIGALSGNIGGGSVSGSSTGSSKNSGNTN---GNRSPLKAPK 333
            |.|.:|:.|           |.|   |..|....||.....||:|:..|..|   |..|..:.|:
  Rat    57 NSLDSDYPSSACSIQSSAPLRAP---AHKGAELNGSCMRPGTGNSQGGGGGNQPPGLNSEQQPPQ 118

  Fly   334 KSGKPLNLAQSNAAANSSLSFSSSLANICSNSNDSNSTATSSSTTNT-SGAPVDLVKSPPPAAGA 397
            ....|                               .|...||.||. ||.|....|..|.|:.:
  Rat   119 PPPPP-------------------------------PTLPPSSPTNPGSGVPAKKTKGGPNASSS 152

  Fly   398 GATGASGKSGEDSGTPIVWPAWVYCTRYSDR-----PSSGRSPRARKPKKPATSSSAAGGGGGGV 457
            .:|.:..          ::| |:..:|.:.:     .:||.:...:.|..||:            
  Rat   153 SSTISKQ----------IFP-WMKESRQNSKQKNSCATSGENCEDKSPPGPAS------------ 194

  Fly   458 EKGEAADGGGVPEDKRPRTAFSGTQLARLKHEFNENRYLTEKRRQQLSGELGLNEAQIKIWFQNK 522
                          ||.|||::..||..|:.||:.||||...||.:::..|.|.|.||||||||:
  Rat   195 --------------KRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNR 245

  Fly   523 RAKLKKSSGTKNPLALQLMAQGLYNHSTIPLTREEEELQELQEAASAAA 571
            |.|.||....|..|           ||  |..:..|....|..||...|
  Rat   246 RMKYKKDQKAKGIL-----------HS--PAGQSPERSPPLGGAAGHVA 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 27/52 (52%)
Engrail_1_C_sig 529..554 CDD:287495 5/24 (21%)
Hoxd3NP_001257967.1 Homeobox 198..251 CDD:395001 27/52 (52%)
DUF4074 369..430 CDD:404218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.