DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and GBX2

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001476.2 Gene:GBX2 / 2637 HGNCID:4186 Length:348 Species:Homo sapiens


Alignment Length:416 Identity:90/416 - (21%)
Similarity:138/416 - (33%) Gaps:167/416 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 YRPSAFSSTATTVLPPSEGPPFS-PEDLLQ--LPPSTGTFQEEFLRKSQLYAEELMKQQMHLMAA 193
            |||        .||||...||.: |:..||  |||:                     ...|.:.:
Human    50 YRP--------VVLPPPPPPPPALPQAALQPALPPA---------------------HPHHQIPS 85

  Fly   194 ARVNALTAAAAGKQLQMAMAAAAVATVPSGQDALAQLTATALGLG------PGGAVHPHQQLLLQ 252
            ......::.|.|    ||:.:..:||:|.|..|..|....|....      |||.          
Human    86 LPTGFCSSLAQG----MALTSTLMATLPGGFSASPQHQEAAAARKFAPQPLPGGG---------- 136

  Fly   253 RDQVHHHHHMQNHLNNNENLHERALKFSIDNILKADFGSR---LPKIGALSGNIGGGSVSGSSTG 314
                                     .|.....|:||....   |.|.|:|.......:|..|..|
Human   137 -------------------------NFDKAEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVG 176

  Fly   315 SSKNSGNTNGNRSPLKAPKKSGKPLNLAQSNAAANSSLSFSSSLANICSNSNDSNSTATSSSTTN 379
            :.:..|.   :.|.::...| ||     :.:.:..|.:.:||          |.|.|..::....
Human   177 AVRGQGK---DESKVEDDPK-GK-----EESFSLESDVDYSS----------DDNLTGQAAHKEE 222

  Fly   380 TSGAPVDLVKSPPPAAGAGATGASGKSGEDSGTPIVWPAWVYCTRYSDRPSSGRSPRARKPKKPA 444
            ..|..::  ::||.:..||:|.::||                                       
Human   223 DPGHALE--ETPPSSGAAGSTTSTGK--------------------------------------- 246

  Fly   445 TSSSAAGGGGGGVEKGEAADGGGVPEDKRPRTAFSGTQLARLKHEFNENRYLTEKRRQQLSGELG 509
                                      ::|.||||:..||..|:.||:..:||:...|.|::..|.
Human   247 --------------------------NRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALK 285

  Fly   510 LNEAQIKIWFQNKRAKLKK-SSGTKN 534
            |:|.|:||||||:|||.|: .:|..|
Human   286 LSEVQVKIWFQNRRAKWKRVKAGNAN 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 26/52 (50%)
Engrail_1_C_sig 529..554 CDD:287495 2/6 (33%)
GBX2NP_001476.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..81 8/42 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..139 7/62 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..251 20/157 (13%)
Homeobox 250..303 CDD:306543 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.