DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and GBX1

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001092304.1 Gene:GBX1 / 2636 HGNCID:4185 Length:363 Species:Homo sapiens


Alignment Length:329 Identity:84/329 - (25%)
Similarity:120/329 - (36%) Gaps:92/329 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 GALSGNIGGGSVSGSSTGSS---------KNSGNTNGNRSPLKAPKKSGKPLNLAQSNAAA---- 348
            |:..|..|||...|..|..|         ..||:......|:..|.   :||.|.|:.|.|    
Human     7 GSAPGGNGGGGGGGPGTAFSIDSLIGPPPPRSGHLLYTGYPMFMPY---RPLVLPQALAPAPLPA 68

  Fly   349 -----NSSLSFSSSLAN-ICSNSNDSNSTATSSSTTNTSGA-PVDLVKSP---PPAAGAGATGAS 403
                 ....||:..|.| .|:....:..:..:.:|...|.| |.|....|   ..||.|.|..|:
Human    69 GLPPLAPLASFAGRLTNTFCAGLGQAVPSMVALTTALPSFAEPPDAFYGPQELAAAAAAAAATAA 133

  Fly   404 GKSGEDSG--------------------TPIVWPAWVYCTRYSDRPSSGRSPRARKPKKPATSSS 448
            ..:.|..|                    .|...|...:...:...|:.|:...:.:.|..|::..
Human   134 RNNPEPGGRRPEGGLEADELLPAREKVAEPPPPPPPHFSETFPSLPAEGKVYSSDEEKLEASAGD 198

  Fly   449 AAG------GGGGGVE----------------------KGEAADGG--GVP----------EDKR 473
            .||      |.||..|                      ||....|.  |.|          :.:|
Human   199 PAGSEQEEEGSGGDSEDDGFLDSSAGGPGALLGPKPKLKGSLGTGAEEGAPVTAGVTAPGGKSRR 263

  Fly   474 PRTAFSGTQLARLKHEFNENRYLTEKRRQQLSGELGLNEAQIKIWFQNKRAKLKK------SSGT 532
            .||||:..||..|:.||:..:||:...|.|::..|.|:|.|:||||||:|||.|:      ||.:
Human   264 RRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRIKAGNVSSRS 328

  Fly   533 KNPL 536
            ..|:
Human   329 GEPV 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 26/52 (50%)
Engrail_1_C_sig 529..554 CDD:287495 3/8 (38%)
GBX1NP_001092304.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 8/23 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..265 22/136 (16%)
Homeobox 264..317 CDD:306543 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.