DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and Hoxc8

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001170797.2 Gene:Hoxc8 / 24460 RGDID:2821 Length:242 Species:Rattus norvegicus


Alignment Length:333 Identity:70/333 - (21%)
Similarity:107/333 - (32%) Gaps:149/333 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 ALGLGPGGAVHPHQQLLLQRDQVHHHHHMQNHLNNNENLHERALKFSIDNILKADFGSRLPKIGA 298
            ||..||||:....|         |..||:|:..::                              
  Rat    37 ALVYGPGGSAPGFQ---------HASHHVQDFFHH------------------------------ 62

  Fly   299 LSGNIGGGSVSGSSTGSSKNSGNTNGNRSPL----KAPKKSGKPLNLAQSNAAANSSLSFSSSLA 359
                 |...:|.|....:..|.:.:|:.|..    ..|::|   |..||..|   |.:.:..   
  Rat    63 -----GTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQS---LYGAQQEA---SVVQYPD--- 113

  Fly   360 NICSNSNDSNSTATSSSTTNTSGAPVDLVKSPPPAAGAGATGASGKSGEDSGTPIVWPAWVYCTR 424
              |.:|.::||:.                             ..|...::|...:::| |:    
  Rat   114 --CKSSANTNSSE-----------------------------GQGHLNQNSSPSLMFP-WM---- 142

  Fly   425 YSDRPSSGRSPRARKPKKPATSSSAAGGGGGGVEKGEAADGGGVPEDKRPRTAFSGTQLARLKHE 489
                          :|..|...|.                          |..:|..|...|:.|
  Rat   143 --------------RPHAPGRRSG--------------------------RQTYSRYQTLELEKE 167

  Fly   490 FNENRYLTEKRRQQLSGELGLNEAQIKIWFQNKRAKLKKSSGTKNPLALQLMAQGLYNHSTIPLT 554
            |..|.|||.|||.::|..|||.|.|:||||||:|.|.||.:                |...:|..
  Rat   168 FLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKEN----------------NKDKLPGA 216

  Fly   555 REEEELQE 562
            |:||:::|
  Rat   217 RDEEKVEE 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 27/52 (52%)
Engrail_1_C_sig 529..554 CDD:287495 2/24 (8%)
Hoxc8NP_001170797.2 Homeobox 153..206 CDD:395001 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.