DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and ceh-16

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001379631.1 Gene:ceh-16 / 191618 WormBaseID:WBGene00000439 Length:187 Species:Caenorhabditis elegans


Alignment Length:177 Identity:87/177 - (49%)
Similarity:102/177 - (57%) Gaps:42/177 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   391 PPPAAGAGATGASGKS---GEDSGTPIV----WPAWVYCTRYSDRPSSGRSPRARKPKKPATSSS 448
            |.|.....||..|..|   ...:|||.:    :||||:.||||||||:|  ||.||.:|..::.|
 Worm    18 PSPTISTPATSPSSISPTFASPNGTPNIASSMYPAWVFSTRYSDRPSAG--PRHRKSRKRESTGS 80

  Fly   449 AAGGGGGGVEKGEAADGGGVPEDKRPRTAFSGTQLARLKHEFNENRYLTEKRRQQLSGELGLNEA 513
            :                |...|:|||||||:|.||.|||.||.|:|||||||||:|:.||||||:
 Worm    81 S----------------GSSEEEKRPRTAFTGDQLDRLKTEFRESRYLTEKRRQELAHELGLNES 129

  Fly   514 QIKIWFQNKRAKLKK----------SSGTKNPL-------ALQLMAQ 543
            |||||||||||||||          ||.|.||.       ..|||||
 Worm   130 QIKIWFQNKRAKLKKSTSSVPRDRCSSVTPNPHNHPSIHGGYQLMAQ 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 42/52 (81%)
Engrail_1_C_sig 529..554 CDD:287495 10/22 (45%)
ceh-16NP_001379631.1 Homeobox 90..144 CDD:395001 43/53 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166993
Domainoid 1 1.000 97 1.000 Domainoid score I4541
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002003
OrthoInspector 1 1.000 - - otm14243
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24341
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2569
SonicParanoid 1 1.000 - - X1139
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.970

Return to query results.
Submit another query.