DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and egl-5

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001021166.1 Gene:egl-5 / 176093 WormBaseID:WBGene00001174 Length:223 Species:Caenorhabditis elegans


Alignment Length:200 Identity:46/200 - (23%)
Similarity:78/200 - (39%) Gaps:53/200 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 ANSSLSFSSSLANICSNSNDSNSTATSSSTTNTSGAPVDLVKSPPPAAGAGATGAS---GKS--- 406
            :.|:..|.||.|:..:.|..|:....:...:..:.....:.|..|..:...:|.||   |.|   
 Worm     4 STSAFDFGSSTASSAATSTTSSQPDANDHLSRLAAMTQGVGKEDPETSSTPSTEASLYPGISAAY 68

  Fly   407 -------------GEDSGTPIVWPAWVYCTRYSDRPSSGRSPRARKPKKPATSSSAAGGGGGGVE 458
                         |:..| |..:|.|..|...:..|:.|.          ..:||          
 Worm    69 MQSYGWPQNYNYFGQPLG-PATFPGWPQCYPNTAWPNYGE----------LFASS---------- 112

  Fly   459 KGEAADGGGVPEDKRPRTAFSGTQLARLKHEFNENRYLTEKRRQQLSGELGLNEAQIKIWFQNKR 523
                         |:.|..:...|.:.|:.:|.::.|:::|:|::|..:..|.:.||||||||:|
 Worm   113 -------------KKGRQTYQRYQTSVLEAKFQQSSYVSKKQREELRLQTQLTDRQIKIWFQNRR 164

  Fly   524 AKLKK 528
            .|.||
 Worm   165 MKAKK 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 19/52 (37%)
Engrail_1_C_sig 529..554 CDD:287495 45/199 (23%)
egl-5NP_001021166.1 Homeobox 116..168 CDD:278475 19/51 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.