Sequence 1: | NP_523699.3 | Gene: | inv / 36239 | FlyBaseID: | FBgn0001269 | Length: | 576 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001021166.1 | Gene: | egl-5 / 176093 | WormBaseID: | WBGene00001174 | Length: | 223 | Species: | Caenorhabditis elegans |
Alignment Length: | 200 | Identity: | 46/200 - (23%) |
---|---|---|---|
Similarity: | 78/200 - (39%) | Gaps: | 53/200 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 348 ANSSLSFSSSLANICSNSNDSNSTATSSSTTNTSGAPVDLVKSPPPAAGAGATGAS---GKS--- 406
Fly 407 -------------GEDSGTPIVWPAWVYCTRYSDRPSSGRSPRARKPKKPATSSSAAGGGGGGVE 458
Fly 459 KGEAADGGGVPEDKRPRTAFSGTQLARLKHEFNENRYLTEKRRQQLSGELGLNEAQIKIWFQNKR 523
Fly 524 AKLKK 528 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
inv | NP_523699.3 | Homeobox | 474..527 | CDD:278475 | 19/52 (37%) |
Engrail_1_C_sig | 529..554 | CDD:287495 | 45/199 (23%) | ||
egl-5 | NP_001021166.1 | Homeobox | 116..168 | CDD:278475 | 19/51 (37%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |