DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and Hoxc5

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_783857.1 Gene:Hoxc5 / 15424 MGIID:96196 Length:222 Species:Mus musculus


Alignment Length:241 Identity:67/241 - (27%)
Similarity:92/241 - (38%) Gaps:66/241 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   344 SNAAANSSLSFSSSLANI-------CSNSNDSNSTATSS--------STTNTSGAP------VDL 387
            |:..||   ||.....||       |.|...::....|.        |.|....||      ||:
Mouse     2 SSYVAN---SFYKQSPNIPAYNMQTCGNYGSASEVQASRYCYGGLDLSITFPPPAPSNSLHGVDM 63

  Fly   388 VKSP---PPAAGAGATGASGKS-GEDSGTPIVWPAWVYCTRYSDRPSSGRSPRARKPKKPATSSS 448
            ..:|   |......|..|.|.: |.|...|:             .|..    .::|..:||....
Mouse    64 AANPRAHPDRPACSAAAAPGHALGRDEAAPL-------------NPGM----YSQKAARPALEER 111

  Fly   449 AAGGGGGGVEKGEAADGGGV---------------------PEDKRPRTAFSGTQLARLKHEFNE 492
            |...|....|:.:.....|:                     .:.||.||:::..|...|:.||:.
Mouse   112 AKSSGEIKEEQAQTGQPAGLSQPPAPPQIYPWMTKLHMSHETDGKRSRTSYTRYQTLELEKEFHF 176

  Fly   493 NRYLTEKRRQQLSGELGLNEAQIKIWFQNKRAKLKKSSGTKNPLAL 538
            |||||.:||.:::..|.|||.||||||||:|.|.||.|..|:..||
Mouse   177 NRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKKDSKMKSKEAL 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 27/52 (52%)
Engrail_1_C_sig 529..554 CDD:287495 4/10 (40%)
Hoxc5NP_783857.1 COG5373 65..>142 CDD:227665 16/93 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..141 15/89 (17%)
Antp-type hexapeptide 140..145 0/4 (0%)
Homeobox 158..212 CDD:395001 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.