DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and Hoxb5

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_032294.2 Gene:Hoxb5 / 15413 MGIID:96186 Length:269 Species:Mus musculus


Alignment Length:265 Identity:77/265 - (29%)
Similarity:119/265 - (44%) Gaps:62/265 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 NIG-GGSVSGS----------STGSSKNSGNTNGNRSPLKA-------------PKKSGKPLNLA 342
            |.| |.|:|||          |.|.:.|..:.:.|||...:             |..:.:| ...
Mouse    23 NYGSGSSLSGSYRDPAAMHTGSYGYNYNGMDLSVNRSSASSSHFGAVGESSRAFPASAQEP-RFR 86

  Fly   343 QSNAAANSSLSFSSSLANICSNSNDSNSTATSSSTTNTSGAPVDLVKSPPPAAGAGAT----GAS 403
            |    |.||.|.||..:..|:| .||:....|:|      :|.|  ::.|.::.|..|    .::
Mouse    87 Q----ATSSCSLSSPESLPCTN-GDSHGAKPSAS------SPSD--QATPASSSANFTEIDEASA 138

  Fly   404 GKSGEDSGTPIVWPAWVYCTRYSDRPSSGRSPRARKPKKPATSSSAAGGGGGGV----EKGEAAD 464
            ....|::.:.:            ..||..|:    :|:..|||::|..|....:    .|...:.
Mouse   139 SSEPEEAASQL------------SSPSLARA----QPEPMATSTAAPEGQTPQIFPWMRKLHISH 187

  Fly   465 GGGVPEDKRPRTAFSGTQLARLKHEFNENRYLTEKRRQQLSGELGLNEAQIKIWFQNKRAKLKKS 529
            ....|:.||.|||::..|...|:.||:.|||||.:||.:::..|.|:|.||||||||:|.|.||.
Mouse   188 DMTGPDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKD 252

  Fly   530 SGTKN 534
            :..|:
Mouse   253 NKLKS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 27/52 (52%)
Engrail_1_C_sig 529..554 CDD:287495 1/6 (17%)
Hoxb5NP_032294.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..173 30/127 (24%)
Antp-type hexapeptide 176..181 0/4 (0%)
Homeobox 198..251 CDD:365835 27/52 (52%)
PRK07003 <67..>171 CDD:235906 29/133 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.