Sequence 1: | NP_523699.3 | Gene: | inv / 36239 | FlyBaseID: | FBgn0001269 | Length: | 576 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_032204.1 | Gene: | Gsx1 / 14842 | MGIID: | 95842 | Length: | 261 | Species: | Mus musculus |
Alignment Length: | 204 | Identity: | 60/204 - (29%) |
---|---|---|---|
Similarity: | 77/204 - (37%) | Gaps: | 38/204 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 367 DSNSTATSSSTTNTSGAPVDL--VKSPPPAAGAG-ATGASGKSGEDSGTPIVWPAWVYCTRYSDR 428
Fly 429 PSSGRSPRARKPKKPATSSSAAGGGG------GGVEKGEAA------------------------ 463
Fly 464 ---DGGGVPEDKRPRTAFSGTQLARLKHEFNENRYLTEKRRQQLSGELGLNEAQIKIWFQNKRAK 525
Fly 526 LKKSSGTKN 534 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
inv | NP_523699.3 | Homeobox | 474..527 | CDD:278475 | 27/52 (52%) |
Engrail_1_C_sig | 529..554 | CDD:287495 | 1/6 (17%) | ||
Gsx1 | NP_032204.1 | SNAG domain. /evidence=ECO:0000250 | 1..20 | 3/11 (27%) | |
Homeobox | 150..203 | CDD:395001 | 27/52 (52%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 201..261 | 3/9 (33%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |