DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and Dlx5

DIOPT Version :10

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_034186.2 Gene:Dlx5 / 13395 MGIID:101926 Length:289 Species:Mus musculus


Alignment Length:105 Identity:24/105 - (22%)
Similarity:40/105 - (38%) Gaps:24/105 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   473 KNPGDSSEGVDV---EALKNSVATAVA------VGGSARSL----------DSLSSNTIAGSTGE 518
            :.|.|..:|.|:   ||..|:...:..      :|...|:|          .|.:||.|.....:
Mouse   150 EGPVDEGDGKDIQEDEAPGNTRKWSSVWVHYRKLGQEPRALCLLCMEKIQHRSSTSNLIRHLQHK 214

  Fly   519 RFQDLA-----PAASESVRSQSNNTTVVSTPSSSSSSTTS 553
            ...:.|     |....:.|...:.|.:.|:|:.||:.|.|
Mouse   215 HPNEFAQLEDHPQKRPNKRKSDDPTRLTSSPTLSSNPTRS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeodomain 472..528 CDD:459649 16/78 (21%)
Engrail_1_C_sig 529..554 CDD:431338 8/25 (32%)
Dlx5NP_034186.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
DLL_N 32..118 CDD:463567
Homeodomain 138..194 CDD:459649 10/43 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..253 12/54 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..289
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.