powered by:
Protein Alignment inv and Cphx1
DIOPT Version :9
Sequence 1: | NP_523699.3 |
Gene: | inv / 36239 |
FlyBaseID: | FBgn0001269 |
Length: | 576 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_780551.1 |
Gene: | Cphx1 / 105594 |
MGIID: | 2145733 |
Length: | 182 |
Species: | Mus musculus |
Alignment Length: | 75 |
Identity: | 25/75 - (33%) |
Similarity: | 33/75 - (44%) |
Gaps: | 15/75 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 467 GVPEDK---------------RPRTAFSGTQLARLKHEFNENRYLTEKRRQQLSGELGLNEAQIK 516
|.||.| :||..||..:|.|||.||....|.....:.:|:.:.....:.|.
Mouse 8 GAPETKDNRSKARKRYGSRNSKPRHKFSRDELKRLKQEFAYAPYPDFTTKDELARQFQCEVSVID 72
Fly 517 IWFQNKRAKL 526
.|||||||:|
Mouse 73 NWFQNKRARL 82
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C167834694 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR24341 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.