DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and Cphx1

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_780551.1 Gene:Cphx1 / 105594 MGIID:2145733 Length:182 Species:Mus musculus


Alignment Length:75 Identity:25/75 - (33%)
Similarity:33/75 - (44%) Gaps:15/75 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   467 GVPEDK---------------RPRTAFSGTQLARLKHEFNENRYLTEKRRQQLSGELGLNEAQIK 516
            |.||.|               :||..||..:|.|||.||....|.....:.:|:.:.....:.|.
Mouse     8 GAPETKDNRSKARKRYGSRNSKPRHKFSRDELKRLKQEFAYAPYPDFTTKDELARQFQCEVSVID 72

  Fly   517 IWFQNKRAKL 526
            .|||||||:|
Mouse    73 NWFQNKRARL 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 21/53 (40%)
Engrail_1_C_sig 529..554 CDD:287495
Cphx1NP_780551.1 homeodomain 29..82 CDD:238039 20/52 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834694
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24341
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.