DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and CPHXL

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001342542.1 Gene:CPHXL / 105371346 HGNCID:51815 Length:405 Species:Homo sapiens


Alignment Length:135 Identity:37/135 - (27%)
Similarity:49/135 - (36%) Gaps:38/135 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   464 DG--GGVPEDK---------------RPRTAFSGTQLARLKHEFNENRYLTEKRRQQLSGELGLN 511
            ||  ||.|.::               :.|..||...|..||..|.||.|.....|:.|:.:....
Human     4 DGTSGGFPAEEDHHNEERQTKNKRKTKHRHKFSEELLQELKEIFGENCYPDYTTRKTLAIKFDCP 68

  Fly   512 EAQIKIWFQNKRAKLKKSS-------GTKNPLALQLMAQGLYNHSTIPLTREEEELQELQEAASA 569
            ...|..|||||||:|..:.       ..|:...:|.       ||.:       ..||.|.||..
Human    69 VNVIDNWFQNKRARLPPAERRRIFVLQKKHDFPVQA-------HSFL-------SCQETQAAAHN 119

  Fly   570 AAAKE 574
            .|.|:
Human   120 YATKQ 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 20/52 (38%)
Engrail_1_C_sig 529..554 CDD:287495 4/31 (13%)
CPHXLNP_001342542.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33 5/28 (18%)
HOX 28..82 CDD:197696 19/53 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 340..363
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144576
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24341
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.