DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and Hoxa3

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001300749.1 Gene:Hoxa3 / 103690130 RGDID:1561431 Length:444 Species:Rattus norvegicus


Alignment Length:162 Identity:54/162 - (33%)
Similarity:80/162 - (49%) Gaps:39/162 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   390 SPPPAAGAGATGASGKSGEDSGTPIVWPAWVYCTRYSDRPSSGRS-----PRARKPKKPATSSSA 449
            |||.:|.:..|.||     .:.:|::           :.|:.|:.     ..:|:..|..||.|:
  Rat   127 SPPQSANSNPTPAS-----TAKSPLL-----------NSPTVGKQIFPWMKESRQNTKQKTSGSS 175

  Fly   450 AGGGGGGVEK--GEAADGGGVPEDKRPRTAFSGTQLARLKHEFNENRYLTEKRRQQLSGELGLNE 512
            :|....|.:.  |:|:       .||.|||::..||..|:.||:.||||...||.:::..|.|.|
  Rat   176 SGESCAGDKSPPGQAS-------SKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTE 233

  Fly   513 AQIKIWFQNKRAKLKK---------SSGTKNP 535
            .||||||||:|.|.||         |||.::|
  Rat   234 RQIKIWFQNRRMKYKKDQKGKGMLTSSGGQSP 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 27/52 (52%)
Engrail_1_C_sig 529..554 CDD:287495 4/7 (57%)
Hoxa3NP_001300749.1 COG5576 <182..309 CDD:227863 38/91 (42%)
Homeobox 196..249 CDD:395001 27/52 (52%)
DUF4074 379..442 CDD:404218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.