DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and hoxb1

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:XP_004918719.1 Gene:hoxb1 / 100493290 XenbaseID:XB-GENE-485772 Length:304 Species:Xenopus tropicalis


Alignment Length:279 Identity:65/279 - (23%)
Similarity:98/279 - (35%) Gaps:78/279 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 SGKPLNLAQSNAA-----------ANSSLSFSSSLAN----------------------ICSNSN 366
            :|.|.:|.|.|.:           .||..|::....|                      .|||:.
 Frog    59 NGVPSHLHQQNPSYPPQPSAGVPYTNSLTSYTPQTCNQAYGHQAYASPDADGIYFQQTAYCSNTG 123

  Fly   367 DSNSTATSSSTTNTSGAPVDLVKSPPPAAGAGATGASGKSGEDSGTPIVWPAWVYCTRYSDRPSS 431
             :||.:.|.........|....:.|......|...|....          |:.::..:....||.
 Frog   124 -ANSNSYSDGYCGAVPGPAQYQQHPYGQEHQGLLQAYHNP----------PSMLHEEKEPSCPSE 177

  Fly   432 GRSPR--------ARKPKKPATSSSAAGGGGGGVEKGEAADGGGVPEDKRPRTAFSGTQLARLKH 488
            ...|.        .|.|  |.|::             :..|.|...:....||.|:..||..|:.
 Frog   178 QALPNHTFDWMKVKRNP--PKTTA-------------KPVDFGLSTQQNTIRTNFTTKQLTELEK 227

  Fly   489 EFNENRYLTEKRRQQLSGELGLNEAQIKIWFQNKRAKLKKSSGTKNPLALQLMAQGLYNHSTIPL 553
            ||:.|:|||..||.:::..|.|||.|:||||||:|.|.||..           .:||...:....
 Frog   228 EFHFNKYLTRARRVEIAATLELNETQVKIWFQNRRMKQKKRE-----------REGLAPSAIKGS 281

  Fly   554 TREEEELQELQEAASAAAA 572
            .:|..|:.:|..:.|..|:
 Frog   282 MKENGEMSDLSSSTSPDAS 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 27/52 (52%)
Engrail_1_C_sig 529..554 CDD:287495 2/24 (8%)
hoxb1XP_004918719.1 PTZ00395 <12..>147 CDD:185594 16/88 (18%)
Homeobox 214..267 CDD:365835 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.