DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and hoxc3

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:XP_002936696.1 Gene:hoxc3 / 100190990 XenbaseID:XB-GENE-5997986 Length:394 Species:Xenopus tropicalis


Alignment Length:306 Identity:83/306 - (27%)
Similarity:112/306 - (36%) Gaps:84/306 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 DNILKADFGSRLPKIGALSGNIGGGSVSGSSTGSSKN--------SGNTNGNRSPLKAPKKSGKP 338
            ||  .|.||.     ....||.|.|.:......|..:        ....||:.|........|..
 Frog    10 DN--SASFGG-----CGFQGNNGMGYLGQQDYPSEDDYQPPFCLPPDTANGSASHKGEHSIKGID 67

  Fly   339 LNLAQSNAAANSSLSFSSSLANICSNSNDSNSTATSSSTTNTSGAPVDL-VKSPPPAAGAGATGA 402
            .:|::.:..|....|.:       |:|....|.:|.|.|:..|..||.. |.||           
 Frog    68 FHLSEVSEQAQQPKSPN-------SDSPLPKSASTQSCTSKKSTGPVSSDVTSP----------- 114

  Fly   403 SGKSGEDSGTP-IVWPAWVYCTRYSDRPSSGRSPRARKPKKPATSSSAAGGGGGGVEKGEAADGG 466
             .|..:.|..| .::| |:..||.:.:......|.|  ...||..||.....             
 Frog   115 -NKKSKGSNMPKQIFP-WMKETRQNSKQKKQAPPPA--DDAPAVDSSFLSSA------------- 162

  Fly   467 GVPEDKRPRTAFSGTQLARLKHEFNENRYLTEKRRQQLSGELGLNEAQIKIWFQNKRAKLKK--- 528
                .||.|||::.:||..|:.||:.||||...||.:::..|.|:|.||||||||:|.|.||   
 Frog   163 ----SKRARTAYTNSQLVELEKEFHFNRYLCRPRRLEMAKLLNLSERQIKIWFQNRRMKFKKDHK 223

  Fly   529 --------------SSGTKNPLALQL-----------MAQGLYNHS 549
                          ||.:..|.:..|           ||.|.||.|
 Frog   224 GKGGGGSPGGLSPSSSPSLMPYSGNLPLDGDCGYEVPMATGAYNKS 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 27/52 (52%)
Engrail_1_C_sig 529..554 CDD:287495 10/32 (31%)
hoxc3XP_002936696.1 Homeobox 167..220 CDD:395001 27/52 (52%)
DUF4074 335..392 CDD:404218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.