DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and hoxb2

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:XP_012808332.1 Gene:hoxb2 / 100038155 XenbaseID:XB-GENE-478525 Length:340 Species:Xenopus tropicalis


Alignment Length:268 Identity:77/268 - (28%)
Similarity:115/268 - (42%) Gaps:63/268 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 SLSFSSSLANICSNSNDSNSTATSS-----STTNTSGAPVDLVKSPP-----PAAGAGATG---- 401
            :|.|...:..|  ||..|.:...:|     .|..||......:..||     |:...|:..    
 Frog     2 NLEFEREIGFI--NSQPSLAECLTSFPAVLETFQTSSIKDSTLIPPPFEQTIPSLNPGSDSQIRP 64

  Fly   402 ASGKSGEDS--GTPIVWPA-------WVYCTRYSDRPSSGRSPRARKPKKPATSSSAAGGGGGGV 457
            .|.|..|:.  ..|.|.|.       |:. .:.|.:.||..||:|..|  |..|:     ||...
 Frog    65 KSQKRAENGLLQQPQVQPGHLATEFPWMK-EKKSAKKSSQGSPQALIP--PPESA-----GGSPA 121

  Fly   458 EKGEAADGGGVPEDKRPRTAFSGTQLARLKHEFNENRYLTEKRRQQLSGELGLNEAQIKIWFQNK 522
            |.....|.||  ..:|.|||::.|||..|:.||:.|:||...||.:::..|.|.|.|:|:||||:
 Frog   122 EPPGLHDAGG--GSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNR 184

  Fly   523 RAKLKKSSGTKN---------------PL----ALQLMAQGLYNHSTIPLTREEEELQELQEAAS 568
            |.|.|:.:..|:               ||    ...:..|||.::.::   ||    ||:::..|
 Frog   185 RMKHKRQTQHKDSQDGEHSYSNPEDGEPLDDGDDSPVYHQGLDSNDSL---RE----QEIRKDPS 242

  Fly   569 AA--AAKE 574
            .|  ::||
 Frog   243 TAMPSSKE 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 25/52 (48%)
Engrail_1_C_sig 529..554 CDD:287495 6/43 (14%)
hoxb2XP_012808332.1 Homeobox 137..190 CDD:365835 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.