DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and AQY1

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_015518.1 Gene:AQY1 / 856322 SGDID:S000006396 Length:305 Species:Saccharomyces cerevisiae


Alignment Length:249 Identity:67/249 - (26%)
Similarity:112/249 - (44%) Gaps:34/249 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ALIGEFLGNLILNFFACG-----------ACTQIEDGTFK------ALAFGLAIFMAITIVGHLS 70
            |.:|||.|..:  |..|.           |.....||:..      |:.||.::..:|.....:|
Yeast    51 AAVGEFCGTFM--FLWCAYVICNVANHDVALVAAPDGSHPGQLIMIAIGFGFSVMFSIWCFAGVS 113

  Fly    71 GGHVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGLGHTSLAPNITEL 135
            ||.:|||::..:.:|..:|..|.....|.|.:..:|...|...:...:.   |...||....:..
Yeast   114 GGALNPAMSLSLCLARAVSPTRCVVMWVSQIVAGMAAGGAASAMTPGEV---LFANSLGLGCSRT 175

  Fly   136 QGLGIEFF-LGLLLVLVVFGACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPARTVGTA 199
            :||.:|.| ..:|.:.|:..|.:  |.::.:.|.|.||:::.:.|:....|||..:||||::|.|
Yeast   176 RGLFLEMFGTAILCLTVLMTAVE--KRETNFMAALPIGISLFIAHVALTAYTGTGVNPARSLGAA 238

  Fly   200 FATDIWAS-HWVYWVGPVLGGVAA--------ALLYTQVLEAKPVPKVNEASEK 244
            .|...:.. ||:||:|.:||.:.|        .|.||..:.|:......|.::|
Yeast   239 VAARYFPHYHWIYWIGTLLGSILAWSVWQLLQILDYTTYVTAEKAASTKEKAQK 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 62/229 (27%)
AQY1NP_015518.1 MIP 54..266 CDD:273306 60/218 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 89 1.000 Domainoid score I1786
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 90 1.000 Inparanoid score I1546
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm9195
orthoMCL 1 0.900 - - OOG6_100198
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 1 1.000 - - X83
TreeFam 1 0.960 - -
109.750

Return to query results.
Submit another query.