DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and FPS1

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_013057.1 Gene:FPS1 / 850683 SGDID:S000003966 Length:669 Species:Saccharomyces cerevisiae


Alignment Length:289 Identity:62/289 - (21%)
Similarity:106/289 - (36%) Gaps:75/289 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LNELKSKELRLWQALIGEFLGNLILNFFACGACTQIE---------------------------- 46
            :|:..|.:....:..:.||:|.:::..|......|:.                            
Yeast   242 INKWSSVKNTYLKEFLAEFMGTMVMIIFGSAVVCQVNVAGKIQQDNFNVALDNLNVTGSSAETID 306

  Fly    47 -------------DGTFKALAFGLAIFMAITIVGH-------LSGGHVNPAVTAGMLVAGRISLI 91
                         .|||..:|.|.|   |..::|:       :||.|:||::|...||.....|.
Yeast   307 AMKSLTSLVSSVAGGTFDDVALGWA---AAVVMGYFCAGGSAISGAHLNPSITLANLVYRGFPLK 368

  Fly    92 RAFFYVVFQCLGAIAGTAAV----KILIDQDYYNGLGHTSLA--------PNITELQGLGIEFFL 144
            :..:|...|.:||..|...:    |.::.:.|.:...:.|:|        |.::..:....||..
Yeast   369 KVPYYFAGQLIGAFTGALILFIWYKRVLQEAYSDWWMNESVAGMFCVFPKPYLSSGRQFFSEFLC 433

  Fly   145 GLLLVLVVFGACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPARTVGTAFA-------- 201
            |.:|....|...||:...|....||.:.:.:.:.:......||.:||.||.:|...|        
Yeast   434 GAMLQAGTFALTDPYTCLSSDVFPLMMFILIFIINASMAYQTGTAMNLARDLGPRLALYAVGFDH 498

  Fly   202 TDIWASH----WVYWVGPVLGGVAAALLY 226
            ..:|..|    ||..|||.:|.:...|:|
Yeast   499 KMLWVHHHHFFWVPMVGPFIGALMGGLVY 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 60/285 (21%)
FPS1NP_013057.1 MIP 244..527 CDD:395174 60/285 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.