powered by:
Protein Alignment Prip and AQY2
DIOPT Version :9
Sequence 1: | NP_001246266.1 |
Gene: | Prip / 36237 |
FlyBaseID: | FBgn0033635 |
Length: | 270 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_013048.1 |
Gene: | AQY2 / 850674 |
SGDID: | S000003975 |
Length: | 149 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 58 |
Identity: | 15/58 - (25%) |
Similarity: | 22/58 - (37%) |
Gaps: | 19/58 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 ALIGEFLGNLILNFFACG-----------ACTQIEDGTFK------ALAFGLAIFMAI 63
|.:|||.|..: |..|. |.|...:|:.. ||.||.::..:|
Yeast 50 AAVGEFCGTFM--FLWCAYVICNVANHDVALTTEPEGSHPGQLIMIALGFGFSVMFSI 105
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Prip | NP_001246266.1 |
MIP |
12..226 |
CDD:294134 |
15/58 (26%) |
AQY2 | NP_013048.1 |
GlpF |
1..149 |
CDD:223653 |
15/58 (26%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0580 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000054 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.900 |
|
Return to query results.
Submit another query.