DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and YLL053C

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_013047.1 Gene:YLL053C / 850673 SGDID:S000003976 Length:152 Species:Saccharomyces cerevisiae


Alignment Length:168 Identity:47/168 - (27%)
Similarity:75/168 - (44%) Gaps:38/168 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 PAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGLGHTSLAPNITELQGLGI 140
            |.:.|||...|..|.:..         |.:..|.|:          |||       .:..:||.:
Yeast     4 PQIIAGMAAGGAASAMTP---------GKVLFTNAL----------GLG-------CSRSRGLFL 42

  Fly   141 EFF-LGLLLVLVVFGACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPARTVGTAFATDI 204
            |.| ..:|.:.|:..|.:  |.::.:.|.|.||:::.:.|:....|||..:||||::|.|.|...
Yeast    43 EMFGTAVLCLTVLMTAVE--KRETNFMAALPIGISLFMAHMALTGYTGTGVNPARSLGAAVAARY 105

  Fly   205 WAS-HWVYWVGPVLGGVAA--------ALLYTQVLEAK 233
            :.. ||:||:.|:||...|        .|.||..:.|:
Yeast   106 FPHYHWIYWISPLLGAFLAWSVWQLLQILDYTTYVNAE 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 44/159 (28%)
YLL053CNP_013047.1 MIP <1..133 CDD:412216 43/156 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 89 1.000 Domainoid score I1786
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.831874 Normalized mean entropy S1947
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm9195
orthoMCL 1 0.900 - - OOG6_100198
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 1 1.000 - - X83
TreeFam 00.000 Not matched by this tool.
98.690

Return to query results.
Submit another query.