DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and AQY3

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_116601.1 Gene:AQY3 / 850490 SGDID:S000001840 Length:646 Species:Saccharomyces cerevisiae


Alignment Length:251 Identity:64/251 - (25%)
Similarity:98/251 - (39%) Gaps:69/251 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EFLGNLILNFFACG-----ACTQIEDGTFKALAF--GLAIFMAITIVGHLSGGHVNPAVTAGMLV 84
            ||||.|:|..|..|     ..|:...|::::|:|  |....:.:.:.|.:||||:|||||..|.:
Yeast   353 EFLGTLVLVIFGVGGNLQATVTKGSGGSYESLSFAWGFGCMLGVYVAGGISGGHINPAVTISMAI 417

  Fly    85 AGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNG-LGHTSLAPNITELQG----------- 137
            ..:....:...|:|.|.:||              |:.| :.:.....:|||.:|           
Yeast   418 FRKFPWKKVPVYIVAQIIGA--------------YFGGAMAYGYFWSSITEFEGGPHIRTTATGA 468

  Fly   138 --------------------LGIEFFLGLLLVLVVFGACDPHKPDSRYTAPLAIGMAVTLGHLGT 182
                                :|....:|.|:.|:    .|.:.|.......|.||..|....:..
Yeast   469 CLFTDPKSYVTWRNAFFDEFIGASILVGCLMALL----DDSNAPPGNGMTALIIGFLVAAIGMAL 529

  Fly   183 IRYTGASMNPARTVGT------------AFATDIWASHWVYWVGPVLGGVAAALLY 226
            ...|..::||||.:|.            ||....|...|..|.||:.||:|.||:|
Yeast   530 GYQTSFTINPARDLGPRIFASMIGYGPHAFHLTHWWWTWGAWGGPIAGGIAGALIY 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 63/249 (25%)
AQY3NP_116601.1 MIP 348..557 CDD:238204 51/221 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.