DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and NIP6;1

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_178191.1 Gene:NIP6;1 / 844415 AraportID:AT1G80760 Length:305 Species:Arabidopsis thaliana


Alignment Length:246 Identity:75/246 - (30%)
Similarity:112/246 - (45%) Gaps:25/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LKSKELRLWQALIGEFLGNLILNFFACGACTQI----EDGTFK----ALAFGLAIFMAITIVGHL 69
            |....:.|::.|..||:|.|||.|  .|..|.|    .||...    |.:.|||:.:.|...||:
plant    71 LPPPNVSLYRKLGAEFVGTLILIF--AGTATAIVNQKTDGAETLIGCAASAGLAVMIVILSTGHI 133

  Fly    70 SGGHVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGLGHTSLAPNITE 134
            ||.|:|||||................|:..|.:.:::...|:|.:.:.....|:    ..|.:..
plant   134 SGAHLNPAVTIAFAALKHFPWKHVPVYIGAQVMASVSAAFALKAVFEPTMSGGV----TVPTVGL 194

  Fly   135 LQGLGIEFFLGLLLVLVVFGACDPHKPDSRYT---APLAIGMAVTLGHLGTIRYTGASMNPARTV 196
            .|...:||.:...|:.||....    .|:|..   |.:|:|..|.|..|.....|.|||||.||:
plant   195 SQAFALEFIISFNLMFVVTAVA----TDTRAVGELAGIAVGATVMLNILIAGPATSASMNPVRTL 255

  Fly   197 GTAFATDIWASHWVYWVGPVLGGVAAALLYTQVLEAKPVPKVNEASEKYRT 247
            |.|.|.:.:.:.|||...|:||.:..|..||.|    .:|:.:||.::.|:
plant   256 GPAIAANNYRAIWVYLTAPILGALIGAGTYTIV----KLPEEDEAPKERRS 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 68/223 (30%)
NIP6;1NP_178191.1 PLN00026 1..305 CDD:177663 75/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.