DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and TIP3;1

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_177462.1 Gene:TIP3;1 / 843653 AraportID:AT1G73190 Length:268 Species:Arabidopsis thaliana


Alignment Length:233 Identity:86/233 - (36%)
Similarity:118/233 - (50%) Gaps:25/233 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QALIGEFLGNLILNFFACGACTQIED---------GT-------FKALAFGLAIFMAITIVGHLS 70
            :|.:.|||...:..|.|.|:...::.         ||       ..|||...|:|.|::...::|
plant    24 RATLAEFLSTFVFVFAAEGSILSLDKLYWEHAAHAGTNTPGGLILVALAHAFALFAAVSAAINVS 88

  Fly    71 GGHVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGLGHTS--LAPNIT 133
            |||||||||.|.||.||::.|||.:|.:.|.||||.....:::..     ||:....  ||..:.
plant    89 GGHVNPAVTFGALVGGRVTAIRAIYYWIAQLLGAILACLLLRLTT-----NGMRPVGFRLASGVG 148

  Fly   134 ELQGLGIEFFLGLLLVLVVFGA-CDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPARTVG 197
            .:.||.:|..|...||.||:.. .||.:......||||||:.|....|....::||||||||..|
plant   149 AVNGLVLEIILTFGLVYVVYSTLIDPKRGSLGIIAPLAIGLIVGANILVGGPFSGASMNPARAFG 213

  Fly   198 TAFATDIWASHWVYWVGPVLGGVAAALLYT-QVLEAKP 234
            .|.....|..||:|||||.:|...|||:|. .|:..:|
plant   214 PALVGWRWHDHWIYWVGPFIGSALAALIYEYMVIPTEP 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 83/222 (37%)
TIP3;1NP_177462.1 MIP 11..268 CDD:412216 86/233 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm8404
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.