DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and BETA-TIP

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_173223.1 Gene:BETA-TIP / 838359 AraportID:AT1G17810 Length:267 Species:Arabidopsis thaliana


Alignment Length:261 Identity:96/261 - (36%)
Similarity:129/261 - (49%) Gaps:44/261 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QALIGEFLGNLILNFFACGAC---------TQIEDGT-------FKALAFGLAIFMAITIVGHLS 70
            :|.:.|||...:..|...|:.         |....||       ..|||..||:|.|::...::|
plant    24 RATLAEFLSTFVFVFAGEGSILALDKLYWDTAAHTGTNTPGGLVLVALAHALALFAAVSAAINVS 88

  Fly    71 GGHVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGLGHTS--LAPNIT 133
            |||||||||...|:.||||:|||.:|.|.|.:|||.....:::..     |||....  :|..::
plant    89 GGHVNPAVTFAALIGGRISVIRAIYYWVAQLIGAILACLLLRLAT-----NGLRPVGFHVASGVS 148

  Fly   134 ELQGLGIEFFLGLLLVLVVFG-ACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPARTVG 197
            ||.||.:|..|...||.||:. |.||.:......||||||:.|....|....:.||||||||..|
plant   149 ELHGLLMEIILTFALVYVVYSTAIDPKRGSIGIIAPLAIGLIVGANILVGGPFDGASMNPARAFG 213

  Fly   198 TAFATDIWASHWVYWVGPVLGGVAAALLYTQVLEAKPVPKVNEASEKYRTHADEREGCKPNHNPN 262
            .|.....|::||:|||||.:||..|||:|..::    :|.|||                |.|:..
plant   214 PALVGWRWSNHWIYWVGPFIGGALAALIYEYMI----IPSVNE----------------PPHHST 258

  Fly   263 H 263
            |
plant   259 H 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 88/222 (40%)
BETA-TIPNP_173223.1 MIP 11..267 CDD:412216 96/261 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm8404
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X83
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.