DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and PIP2;4

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_200874.1 Gene:PIP2;4 / 836187 AraportID:AT5G60660 Length:291 Species:Arabidopsis thaliana


Alignment Length:250 Identity:95/250 - (38%)
Similarity:122/250 - (48%) Gaps:34/250 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KELRLW---QALIGEFLGNL------ILNFFACGACTQIEDGTFK---------ALAFGLAIFMA 62
            :|||.|   :|:|.||:..|      ||......|.|....|...         |.|||..||:.
plant    30 EELRKWPLYRAVIAEFVATLLFLYVSILTVIGYKAQTDATAGGVDCGGVGILGIAWAFGGMIFVL 94

  Fly    63 ITIVGHLSGGHVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYN--GLGH 125
            :.....:||||:|||||.|:.:|.::||:|...|:|.||||||.|...|| .....||.  |.|.
plant    95 VYCTAGISGGHINPAVTVGLFLARKVSLVRTVLYIVAQCLGAICGCGFVK-AFQSSYYTRYGGGA 158

  Fly   126 TSLAPNITELQGLGIEFFLGLLLVLVVFGACDP-------HKPDSRYTAPLAIGMAVTLGHLGTI 183
            ..||....:..|||.|.....:||..||.|.||       |.|   ..|||.||.||.:.||.||
plant   159 NELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVP---VLAPLPIGFAVFMVHLATI 220

  Fly   184 RYTGASMNPARTVGTAFATD---IWASHWVYWVGPVLGGVAAALLYTQVLEAKPV 235
            ..||..:||||:.|.|...:   .|...|::||||::|..|||..:..:|.|..:
plant   221 PITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPMIGAAAAAFYHQFILRAAAI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 93/239 (39%)
PIP2;4NP_200874.1 MIP 31..266 CDD:395174 93/238 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 138 1.000 Domainoid score I1563
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I1775
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm1071
orthoMCL 1 0.900 - - OOG6_100198
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.740

Return to query results.
Submit another query.