DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and TIP2;3

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_199556.1 Gene:TIP2;3 / 834794 AraportID:AT5G47450 Length:250 Species:Arabidopsis thaliana


Alignment Length:241 Identity:78/241 - (32%)
Similarity:120/241 - (49%) Gaps:23/241 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKFEYSLGLNELKSKELRLWQALIGEFLGNLILNFFACGACTQI----EDGTFK-------ALA 54
            :|....|..::.||        |.:.||:..|:..|...|:....    .||...       |:|
plant     6 VGSVGDSFSVSSLK--------AYLSEFIATLLFVFAGVGSAVAFAKLTSDGALDPAGLVAIAIA 62

  Fly    55 FGLAIFMAITIVGHLSGGHVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDY 119
            ...|:|:.::|..::||||:|||||.|:.:.|.|:||..|||.:.||||:|   .|..:|:....
plant    63 HAFALFVGVSIAANISGGHLNPAVTLGLAIGGNITLITGFFYWIAQCLGSI---VACLLLVFVTN 124

  Fly   120 YNGLGHTSLAPNITELQGLGIEFFLGLLLVLVVFG-ACDPHKPDSRYTAPLAIGMAVTLGHLGTI 183
            ...:....::..:..::|:.:|..:...||..|:. |.||.|......||:|||..|....|...
plant   125 GKSVPTHGVSAGLGAVEGVVMEIVVTFALVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAG 189

  Fly   184 RYTGASMNPARTVGTAFATDIWASHWVYWVGPVLGGVAAALLYTQV 229
            .::|.||||||:.|.|..:...:..|:|||||::||..|.|:|..|
plant   190 PFSGGSMNPARSFGPAVVSGDLSQIWIYWVGPLVGGALAGLIYGDV 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 74/225 (33%)
TIP2;3NP_199556.1 PLN00166 1..250 CDD:165733 78/241 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm8404
orthoMCL 1 0.900 - - OOG6_100198
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.