DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and NIP4;1

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_198597.1 Gene:NIP4;1 / 833759 AraportID:AT5G37810 Length:283 Species:Arabidopsis thaliana


Alignment Length:245 Identity:67/245 - (27%)
Similarity:112/245 - (45%) Gaps:17/245 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LWQALIGEFLGNLILNFFACG--ACTQIEDGTFK----ALAFGLAIFMAITIVGHLSGGHVNPAV 78
            |.|.||.|.:|...:.|..||  ....:..||..    .:.:||.:.:.|...||:||.|.||||
plant    41 LTQKLIAEMIGTYFIVFSGCGVVVVNVLYGGTITFPGICVTWGLIVMVMIYSTGHISGAHFNPAV 105

  Fly    79 TAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGLGHTSLAPNITELQGLGIEFF 143
            |....:..|....:...|:..|..|::..:..::::.........|.|   |..:..:.|..|..
plant   106 TVTFAIFRRFPWHQVPLYIGAQFAGSLLASLTLRLMFKVTPEAFFGTT---PADSPARALVAEII 167

  Fly   144 LGLLLVLVVFGACDPHKPDSRYT---APLAIGMAVTLGHLGTIRYTGASMNPARTVGTAFATDIW 205
            :..||:.|:.|..    .|:|..   |.:|:||.:.:........:||||||||::|.|....::
plant   168 ISFLLMFVISGVA----TDNRAVGELAGIAVGMTIMVNVFVAGPISGASMNPARSLGPALVMGVY 228

  Fly   206 ASHWVYWVGPVLGGVAAALLYTQV-LEAKPVPKVNEASEKYRTHADEREG 254
            ...|||.||||||.::...:|..: ...||:.::.:::...|..:...:|
plant   229 KHIWVYIVGPVLGVISGGFVYNLIRFTDKPLRELTKSASFLRAVSPSHKG 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 62/214 (29%)
NIP4;1NP_198597.1 PLN00182 1..283 CDD:165748 67/245 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.