DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and TIP1;3

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_192056.1 Gene:TIP1;3 / 828051 AraportID:AT4G01470 Length:252 Species:Arabidopsis thaliana


Alignment Length:235 Identity:82/235 - (34%)
Similarity:117/235 - (49%) Gaps:27/235 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QALIGEFLGNLILNF------FACGACTQIEDG-------TFKALAFGLAIFMAITIVGHLSGGH 73
            :|...||...:|..|      .|.|..|  .||       ...:|:...|:|:|:::..::||||
plant    21 RAAFAEFFSMVIFVFAGQGSGMAYGKLT--GDGPATPAGLVAASLSHAFALFVAVSVGANVSGGH 83

  Fly    74 VNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGL--GHTSLAPNITELQ 136
            ||||||.|..:.|.|:|:||..|.:.|.|||:.....:|:..     .|:  ...||:..:|...
plant    84 VNPAVTFGAFIGGNITLLRAILYWIAQLLGAVVACLLLKVST-----GGMETAAFSLSYGVTPWN 143

  Fly   137 GLGIEFFLGLLLVLVVFG-ACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPARTVGTAF 200
            .:..|..:...||..|:. |.||.|.|....||||||:.|....|....:.|||||||.:.|.|.
plant   144 AVVFEIVMTFGLVYTVYATAVDPKKGDIGIIAPLAIGLIVGANILVGGAFDGASMNPAVSFGPAV 208

  Fly   201 ATDIWASHWVYWVGPVLGGVAAALLYTQVLEA----KPVP 236
            .:.||.:||||||||.:|...||::|..:...    :|:|
plant   209 VSWIWTNHWVYWVGPFIGAAIAAIVYDTIFIGSNGHEPLP 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 79/219 (36%)
TIP1;3NP_192056.1 PLN00027 1..252 CDD:177664 82/235 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm8404
orthoMCL 1 0.900 - - OOG6_100198
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.