DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and TIP2;2

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_193465.1 Gene:TIP2;2 / 827446 AraportID:AT4G17340 Length:250 Species:Arabidopsis thaliana


Alignment Length:238 Identity:78/238 - (32%)
Similarity:119/238 - (50%) Gaps:21/238 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QALIGEFLGNLILNFFACGACTQIEDGTFK-----------ALAFGLAIFMAITIVGHLSGGHVN 75
            :|.:.||:..|:..|...|:.......|..           |:|...|:|:.::|..::||||:|
plant    19 KAYLSEFIATLLFVFAGVGSALAFAKLTSDAALDPAGLVAVAVAHAFALFVGVSIAANISGGHLN 83

  Fly    76 PAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGLGHTSLAPNITELQGLGI 140
            ||||.|:.|.|.|::|..|||.:.||||:|   .|..:|:.......:....:|..:..::|:.:
plant    84 PAVTLGLAVGGNITVITGFFYWIAQCLGSI---VACLLLVFVTNGESVPTHGVAAGLGAIEGVVM 145

  Fly   141 EFFLGLLLVLVVFG-ACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPARTVGTAFATDI 204
            |..:...||..|:. |.||.|......||:|||..|....|....::|.||||||:.|.|..:..
plant   146 EIVVTFALVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVVSGD 210

  Fly   205 WASHWVYWVGPVLGGVAAALLYTQVL--EAKPVPKVNEASEKY 245
            ::..|:|||||::||..|.|:|..|.  ...|.|    .:|.|
plant   211 FSQIWIYWVGPLVGGALAGLIYGDVFIGSYAPAP----TTESY 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 72/215 (33%)
TIP2;2NP_193465.1 PLN00166 1..250 CDD:165733 78/238 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm8404
orthoMCL 1 0.900 - - OOG6_100198
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X83
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.730

Return to query results.
Submit another query.