DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and PIP2A

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001030851.1 Gene:PIP2A / 824510 AraportID:AT3G53420 Length:287 Species:Arabidopsis thaliana


Alignment Length:250 Identity:93/250 - (37%)
Similarity:120/250 - (48%) Gaps:42/250 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ELRLW---QALIGEFLGNLILNFFA-------------------CGACTQIEDGTFKALAFGLAI 59
            ||:.|   :|:|.||:..|:..:..                   ||....:  |.  |.|||..|
plant    31 ELKKWSFYRAVIAEFVATLLFLYITVLTVIGYKIQSDTDAGGVDCGGVGIL--GI--AWAFGGMI 91

  Fly    60 FMAITIVGHLSGGHVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYN--G 122
            |:.:.....:||||:|||||.|:.:|.::||.||..|::.||||||.|...|| .....||.  |
plant    92 FILVYCTAGISGGHINPAVTFGLFLARKVSLPRALLYIIAQCLGAICGVGFVK-AFQSSYYTRYG 155

  Fly   123 LGHTSLAPNITELQGLGIEFFLGLLLVLVVFGACDP-------HKPDSRYTAPLAIGMAVTLGHL 180
            .|..|||...:...||..|.....:||..||.|.||       |.|   ..|||.||.||.:.||
plant   156 GGANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVP---VLAPLPIGFAVFMVHL 217

  Fly   181 GTIRYTGASMNPARTVGTAF---ATDIWASHWVYWVGPVLGGVAAALLYTQVLEA 232
            .||..||..:||||:.|.|.   .:..|..||::||||.:|...||..:..||.|
plant   218 ATIPITGTGINPARSFGAAVIYNKSKPWDDHWIFWVGPFIGAAIAAFYHQFVLRA 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 90/242 (37%)
PIP2ANP_001030851.1 MIP 31..266 CDD:395174 90/242 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 138 1.000 Domainoid score I1563
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I1775
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm1071
orthoMCL 1 0.900 - - OOG6_100198
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X83
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.740

Return to query results.
Submit another query.