DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and TIP2

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_189283.1 Gene:TIP2 / 822259 AraportID:AT3G26520 Length:253 Species:Arabidopsis thaliana


Alignment Length:217 Identity:75/217 - (34%)
Similarity:108/217 - (49%) Gaps:15/217 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QALIGEFLGNLILNFFACG---ACTQIEDG--------TFKALAFGLAIFMAITIVGHLSGGHVN 75
            :|.:.||:..||..|...|   |..:|.|.        ...|||....:|:|:::..::||||||
plant    22 RAALAEFISTLIFVFAGSGSGIAFNKITDNGATTPSGLVAAALAHAFGLFVAVSVGANISGGHVN 86

  Fly    76 PAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGLGHTSLAPNITELQGLGI 140
            ||||.|:|:.|.|:|:|...|.:.|.||::|....:......:.....|   |:..:..|..|..
plant    87 PAVTFGVLLGGNITLLRGILYWIAQLLGSVAACFLLSFATGGEPIPAFG---LSAGVGSLNALVF 148

  Fly   141 EFFLGLLLVLVVFG-ACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPARTVGTAFATDI 204
            |..:...||..|:. |.||........||:|||..|....|....::|||||||...|.|..:..
plant   149 EIVMTFGLVYTVYATAVDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMNPAVAFGPAVVSWT 213

  Fly   205 WASHWVYWVGPVLGGVAAALLY 226
            |.:|||||.||::||..|.::|
plant   214 WTNHWVYWAGPLIGGGLAGIIY 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 74/215 (34%)
TIP2NP_189283.1 PLN00027 1..253 CDD:177664 75/217 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm8404
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.