DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and RD28

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_181255.1 Gene:RD28 / 818294 AraportID:AT2G37180 Length:285 Species:Arabidopsis thaliana


Alignment Length:252 Identity:94/252 - (37%)
Similarity:119/252 - (47%) Gaps:42/252 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SKELRLW---QALIGEFLGNLILNFFA-------------------CGACTQIEDGTFK-ALAFG 56
            ::||..|   :|:|.||:..|:..:..                   ||..     |... |.|||
plant    27 AEELTKWSLYRAVIAEFVATLLFLYVTVLTVIGYKIQSDTKAGGVDCGGV-----GILGIAWAFG 86

  Fly    57 LAIFMAITIVGHLSGGHVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYN 121
            ..||:.:.....:||||:|||||.|:.:|.::|||||..|:|.||||||.|...||......|.|
plant    87 GMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQSSHYVN 151

  Fly   122 -GLGHTSLAPNITELQGLGIEFFLGLLLVLVVFGACDP-------HKPDSRYTAPLAIGMAVTLG 178
             |.|...||.......||..|.....:||..||.|.||       |.|   ..|||.||.||.:.
plant   152 YGGGANFLADGYNTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVP---VLAPLPIGFAVFMV 213

  Fly   179 HLGTIRYTGASMNPARTVGTAF---ATDIWASHWVYWVGPVLGGVAAALLYTQVLEA 232
            ||.||..||..:||||:.|.|.   .:..|..||::||||.:|...||..:..||.|
plant   214 HLATIPITGTGINPARSFGAAVIFNKSKPWDDHWIFWVGPFIGATIAAFYHQFVLRA 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 91/244 (37%)
RD28NP_181255.1 MIP 29..264 CDD:395174 91/242 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 138 1.000 Domainoid score I1563
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I1775
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm1071
orthoMCL 1 0.900 - - OOG6_100198
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X83
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.740

Return to query results.
Submit another query.