DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and PIP2B

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001323849.1 Gene:PIP2B / 818293 AraportID:AT2G37170 Length:328 Species:Arabidopsis thaliana


Alignment Length:244 Identity:93/244 - (38%)
Similarity:119/244 - (48%) Gaps:39/244 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LWQALIGEFLGNLILNFFA-------------------CGACTQIEDGTFKALAFGLAIFMAITI 65
            |::|:|.||:..|:..:..                   ||....:  |.  |.|||..||:.:..
plant    78 LYRAVIAEFVATLLFLYITVLTVIGYKIQSDTKAGGVDCGGVGIL--GI--AWAFGGMIFILVYC 138

  Fly    66 VGHLSGGHVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYN--GLGHTSL 128
            ...:||||:|||||.|:.:|.::|||||..|:|.||||||.|...|| .....||:  |.|..||
plant   139 TAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGFVK-AFQSSYYDRYGGGANSL 202

  Fly   129 APNITELQGLGIEFFLGLLLVLVVFGACDP-------HKPDSRYTAPLAIGMAVTLGHLGTIRYT 186
            |.......||..|.....:||..||.|.||       |.|   ..|||.||.||.:.||.||..|
plant   203 ADGYNTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVP---VLAPLPIGFAVFMVHLATIPIT 264

  Fly   187 GASMNPARTVGTAF---ATDIWASHWVYWVGPVLGGVAAALLYTQVLEA 232
            |..:||||:.|.|.   .:..|..||::||||.:|...||..:..||.|
plant   265 GTGINPARSFGAAVIYNKSKPWDDHWIFWVGPFIGAAIAAFYHQFVLRA 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 90/236 (38%)
PIP2BNP_001323849.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 138 1.000 Domainoid score I1563
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I1775
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm1071
orthoMCL 1 0.900 - - OOG6_100198
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.740

Return to query results.
Submit another query.