DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and GAMMA-TIP

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_181221.1 Gene:GAMMA-TIP / 818255 AraportID:AT2G36830 Length:251 Species:Arabidopsis thaliana


Alignment Length:221 Identity:73/221 - (33%)
Similarity:108/221 - (48%) Gaps:23/221 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QALIGEFLGNLILNFFACGACTQI------EDG-------TFKALAFGLAIFMAITIVGHLSGGH 73
            :|.:.||:..||  |...|:.:.:      |:|       ...|:|....:|:|:::..::||||
plant    21 KAALAEFISTLI--FVVAGSGSGMAFNKLTENGATTPSGLVAAAVAHAFGLFVAVSVGANISGGH 83

  Fly    74 VNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGLGHTS--LAPNITELQ 136
            ||||||.|..:.|.|:|:|...|.:.|.||::.....:|...     .||...:  |:..:..|.
plant    84 VNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLILKFAT-----GGLAVPAFGLSAGVGVLN 143

  Fly   137 GLGIEFFLGLLLVLVVFG-ACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPARTVGTAF 200
            ....|..:...||..|:. |.||........||:|||..|....|....::|||||||...|.|.
plant   144 AFVFEIVMTFGLVYTVYATAIDPKNGSLGTIAPIAIGFIVGANILAGGAFSGASMNPAVAFGPAV 208

  Fly   201 ATDIWASHWVYWVGPVLGGVAAALLY 226
            .:..|.:|||||.||::||..|.|:|
plant   209 VSWTWTNHWVYWAGPLVGGGIAGLIY 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 72/219 (33%)
GAMMA-TIPNP_181221.1 PLN00027 1..251 CDD:177664 73/221 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm8404
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.