DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and TIP4;1

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_180152.1 Gene:TIP4;1 / 817123 AraportID:AT2G25810 Length:249 Species:Arabidopsis thaliana


Alignment Length:232 Identity:86/232 - (37%)
Similarity:118/232 - (50%) Gaps:20/232 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QALIGEFLGNLILNFFACGACTQIED-------GTFKALAFGLAIFMAITI-VGHLSGGHVNPAV 78
            :|||.||:...:..|...|:....:.       |.| |:|...|..:|:.| .||:||||:||||
plant    19 KALIVEFITTFLFVFAGVGSAMATDSLVGNTLVGLF-AVAVAHAFVVAVMISAGHISGGHLNPAV 82

  Fly    79 TAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGLG---HTSLAPNITELQGLGI 140
            |.|:|:.|.||:.|||.|.:.|.|.:.|....:..|.     .|:|   || ||..::..||:..
plant    83 TLGLLLGGHISVFRAFLYWIDQLLASSAACFLLSYLT-----GGMGTPVHT-LASGVSYTQGIIW 141

  Fly   141 EFFLGLLLVLVVFGA-CDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPARTVGTAFATDI 204
            |..|...|:..|:.. .||.|.......||..|..|....|....::||||||||:.|.|..:..
plant   142 EIILTFSLLFTVYATIVDPKKGSLDGFGPLLTGFVVGANILAGGAFSGASMNPARSFGPALVSGN 206

  Fly   205 WASHWVYWVGPVLGGVAAALLYTQVLEAKP-VPKVNE 240
            |..||||||||::||..|..:|..||..:| ||..::
plant   207 WTDHWVYWVGPLIGGGLAGFIYENVLIDRPHVPVADD 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 80/215 (37%)
TIP4;1NP_180152.1 MIP 1..234 CDD:350945 83/221 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm8404
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X83
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.