DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and PIP2;8

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_179277.1 Gene:PIP2;8 / 816186 AraportID:AT2G16850 Length:278 Species:Arabidopsis thaliana


Alignment Length:258 Identity:95/258 - (36%)
Similarity:132/258 - (51%) Gaps:28/258 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LKSKELRLW---QALIGEFLGNLILNFFA----------CGACTQIEDGTFK-ALAFGLAIFMAI 63
            |...||:||   :|:|.||:..|:..:..          .|.|..:  |... |.|||..||:.:
plant    24 LDMAELKLWSFYRAIIAEFIATLLFLYVTVATVIGHKNQTGPCGGV--GLLGIAWAFGGMIFVLV 86

  Fly    64 TIVGHLSGGHVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYN-GLGHTS 127
            .....:||||:|||||.|:.:|.::||.||..|:|.||||||.|...||..:...|.. |.|..:
plant    87 YCTAGISGGHINPAVTFGLFLARKVSLPRAVAYMVAQCLGAICGVGLVKAFMMTPYKRLGGGANT 151

  Fly   128 LAPNITELQGLGIEFFLGLLLVLVVFGACDPHKP--DSR--YTAPLAIGMAVTLGHLGTIRYTGA 188
            :|...:....||.|.....:||..||.|.||.:.  ||.  ..|||.||.||.:.||.||..||.
plant   152 VADGYSTGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGT 216

  Fly   189 SMNPARTVGTAFATD---IWASHWVYWVGPVLGGVAAALLYTQVLEAKPVPKVNEASEKYRTH 248
            .:||||:.|.|...:   .|..||::||||.:|.:|||..:..:|.|..:    :|...:|::
plant   217 GINPARSFGAAVIYNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAI----KALASFRSN 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 91/234 (39%)
PIP2;8NP_179277.1 MIP 28..257 CDD:395174 90/230 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 138 1.000 Domainoid score I1563
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I1775
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm1071
orthoMCL 1 0.900 - - OOG6_100198
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X83
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.740

Return to query results.
Submit another query.