DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and Aqp9

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_075249.1 Gene:Aqp9 / 65054 RGDID:68433 Length:295 Species:Rattus norvegicus


Alignment Length:282 Identity:80/282 - (28%)
Similarity:115/282 - (40%) Gaps:67/282 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LKSKELRLWQALIGEFLGNLILNFFACGACTQ--IEDGTFKA-----LAFGLAIFMAITIVGHLS 70
            |||   |:.:..:.||||..|:....|.:..|  :....|..     :.|..|:.||:.:...:|
  Rat    18 LKS---RIAKETLSEFLGTFIMIVLGCSSIAQAVLSRERFGGIITINIGFASAVVMALYVTFGIS 79

  Fly    71 GGHVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGL-----------G 124
            |||:||||:..|...||:...:..|||..|.|||..|.|.|..:    ||:||           |
  Rat    80 GGHINPAVSFAMCAFGRMEWFKFPFYVGAQFLGAFVGAATVFGI----YYDGLMAFAGGKLLVVG 140

  Fly   125 H--------TSLAPNITELQGLGIEFFLGLLLVLVVFGACDPHK---PDSRYTAPLAIGMAVTLG 178
            .        |..||.|:.......:....:.|:|:||...|...   |  |...|:.||:.:.:.
  Rat   141 ENATAFIFATYPAPFISTPGAFVDQVVSTMFLLLIVFAMFDSRNLGVP--RGLEPVVIGLLIIVL 203

  Fly   179 HLGTIRYTGASMNPAR------------------TVGTAFATDIWASHWVYWVGPVLGGVAAALL 225
            .......:|.:|||||                  |||..|    |   |:..|||::|.....|:
  Rat   204 SCSLGLNSGCAMNPARDLSPRLFTALAGWGFEVFTVGNNF----W---WIPVVGPMIGAFLGGLI 261

  Fly   226 Y---TQVLEAKPVPKVN-EASE 243
            |   .|:..:|..|.:. |.||
  Rat   262 YILFIQMHHSKLDPDMKAEPSE 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 73/259 (28%)
Aqp9NP_075249.1 MIP 4..266 CDD:412216 74/263 (28%)
NPA 1. /evidence=ECO:0000250|UniProtKB:Q96PS8 84..86 1/1 (100%)
NPA 2. /evidence=ECO:0000250|UniProtKB:Q96PS8 216..218 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.